PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA45G00023
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 141aa    MW: 16419.6 Da    PI: 7.6045
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA45G00023genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1383.6e-122683562
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                ++++rk++NRe+Ar+sR +K++ ++ L   v +L+ eN++    ++  ++++ ++++e
  AA45G00023 26 RKQKRKISNRESARKSRMKKQKLLDDLIAQVIQLKRENHEIVTSVNITTQHYLTVETE 83
                79*************************************9988888777777766666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.5E-111870No hitNo description
SMARTSM003387.9E-172286IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.7832487IPR004827Basic-leucine zipper domain
PfamPF001709.2E-92670IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.25E-112678No hitNo description
CDDcd147021.68E-152777No hitNo description
PROSITE patternPS0003602944IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0080149Biological Processsucrose induced translational repression
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MESSSSSAIP TSSGSEEILV NVMEERKQKR KISNRESARK SRMKKQKLLD DLIAQVIQLK  60
RENHEIVTSV NITTQHYLTV ETENSVLRAQ LNELKKRLHS LNEIIQFLST DNWETYEMNA  120
FYMNQQQQQQ PLMASCDALL Y
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00470DAPTransfer from AT4G34590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009108719.11e-49PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A087GJN71e-49A0A087GJN7_ARAAL; Uncharacterized protein
STRINGBra034639.1-P4e-49(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34590.14e-46G-box binding factor 6